Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: B7MCS1
RecName: 30S ribosomal protein S8
Begin-End: 5-130
Organism: Escherichia coli O45:K1
Interaction Mode:   

Sequence:
DPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLK
YFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGE
IICYVA
Structures of the domain B7MCS1 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uz4 X-ray 5.8 H 4-129 None


© NPIDB team 2003 - 2021

text