Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: B7MCV7
RecName: 30S ribosomal protein S12
Begin-End: 12-123
Organism: Escherichia coli O45:K1
Interaction Mode:   

Sequence:
RARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRKVCRVRLTNGFEVTSYIGGEG
HNLQEHSVILIRGGRVKDLPGVRYHTVRGALDCSGVKDRKQARSKYGVKRPK
Structures of the domain B7MCV7 12-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5uz4 X-ray 5.8 L 11-122 None


© NPIDB team 2003 - 2021

text