Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: B7MFL0
RecName: DNA-directed RNA polymerase subunit omega
Begin-End: 8-60
Organism: Escherichia coli O45:K1
Interaction Mode:   

Sequence:
DAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
Structures of the domain B7MFL0 8-60
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6b6h X-ray 3.9 E 8-60 None


© NPIDB team 2003 - 2021

text