Pfam domain
Pfam family: RNA_pol_Rpb2_45 (PF10385.11)
Uniprot AC: B7MIX3
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 591-656
Organism: Escherichia coli O45:K1
Interaction Mode:   

Sequence:
YRKVTDGVVTDEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQV
DYMDVS
Structures of the domain B7MIX3 591-656
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pmi X-ray 3.86 C 591-656 None
6pb5 X-ray 4.52 C 591-656 None
6b6h X-ray 3.9 C 591-656 None
6pmj X-ray 3.91 C 591-656 None
6pb6 X-ray 4.29 C 591-656 None
6pb4 X-ray 4.35 C 591-656 None


© NPIDB team 2003 - 2021

text