Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: B7NZS8
RecName: Ribosomal protein S9 (Predicted)
Begin-End: 108-154
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
RRLQTQVFKLGLAKSIHHARVLIRQRHIRVRKQVVNIPSFIVRLDSQ
Structures of the domain B7NZS8 108-154
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6yal X-ray 3 L 108-154 None
4d5l X-ray 9 J 108-154 None
4kzx X-ray 7.81 J 108-154 None
4kzy X-ray 7.01 J 108-154 None
4kzz X-ray 7.03 J 108-154 None
7jqc X-ray 3.3 K 108-154 None
6p4h X-ray 3.2 K 108-154 None
4d61 X-ray 9 J 108-154 None
6p4g X-ray 3.1 K 108-154 None
5k0y X-ray 5.8 K 108-154 None
6yan X-ray 3.48 L 108-154 None
7jqb X-ray 2.7 K 108-154 None


© NPIDB team 2003 - 2021

text