Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: B9PHL8
RecName: Ribosomal protein RPS23
Begin-End: 29-137
Organism: Toxoplasma gondii
Interaction Mode:   

Sequence:
KAHLGTRWKANPFGGSSHAKGIVVEKLGIEAKQPNSAIRKCVRVQLIKNGKKITAFVPRD
GSLNYIDENDEVLVAGFGRSGHAVGDIPGVRFKVVKVAGASLLALFKEK
Structures of the domain B9PHL8 29-137
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xxu X-ray 3.35 X 29-137 None


© NPIDB team 2003 - 2021

text