Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: B9PQU8
RecName: 40S ribosomal protein S9, putative
Begin-End: 107-153
Organism: Toxoplasma gondii
Interaction Mode:   

Sequence:
RRLQTKVFKLGLAKSIHHARVLIRQRHIRVGKHIVDIPSFMVRVDSE
Structures of the domain B9PQU8 107-153
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xxu X-ray 3.35 J 107-153 None


© NPIDB team 2003 - 2021

text