Pfam domain
Pfam family: RNA_pol_Rpb1_4 (PF05000.19)
Uniprot AC: C3SIA2
RecName: DNA-directed RNA polymerase subunit beta'
Begin-End: 673-764
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFNSIYMMADSGARG
SAAQIRQLAGMRGLMAKPDGSIIETPITANFR
Structures of the domain C3SIA2 673-764
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6z9s X-ray 4.4 Y 673-764 None
6z9p X-ray 3.9 Y 673-764 None
7ade X-ray 4.2 Y 673-764 None
7adc X-ray 4 Y 673-764 None
6z9t X-ray 4.1 Y 673-764 None
7add X-ray 4.3 Y 673-764 None
7adb X-ray 4.4 Y 673-764 None
6z9r X-ray 4.1 Y 673-764 None
6z9q X-ray 5.7 Y 673-764 None


© NPIDB team 2003 - 2021

text