Pfam domain
Pfam family: NusG (PF02357.21)
Uniprot AC: C3SID2
RecName: Transcription termination/antitermination protein NusG
Begin-End: 7-112
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KRWYVVQAFSGFEGRVATSLREHIKLHNMEDLFGEVMVPTEEVVEIRGGQRRKSERKFFP
GYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAPISDKEVDAIM
Structures of the domain C3SID2 7-112
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6z9p X-ray 3.9 G 7-112 None
6z9r X-ray 4.1 G 7-112 None
6z9q X-ray 5.7 G 7-112 None


© NPIDB team 2003 - 2021

text