Pfam domain
Pfam family: Metallophos (PF00149.30)
Uniprot AC: C4M1P9
RecName: RNA lariat debranching enzyme, putative
Begin-End: 7-234
Organism: Entamoeba histolytica
Interaction Mode:   

Sequence:
QHIAIVGCVHGKYREMYRQLSEYEKSTGKEISFVICTGDMQTLRYEADLVYLKVPPKYKQ
MGDFHLYYEGKEKAPYLTLFIGGNHESSNVLLHLYNGGFVCFNMYYLGVCSCININGLRI
VGVSGIYKSFDEKKPYTYPPSPNDVVSLFHTRNYVIQMLSNLSQSSQIDISLSHDWPQGI
VMKGNYKQLYRFQPGFKKDGASLGSPINKVILNTLKPKYWISGHMHCE
Structures of the domain C4M1P9 7-234
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5k77 X-ray 2.17 E 7-234 None
5k77 X-ray 2.17 D 7-234 None
5k77 X-ray 2.17 C 7-234 None
5k77 X-ray 2.17 B 7-234 None
5k77 X-ray 2.17 A 7-234 None
5k78 X-ray 2.64 E 7-234 None
5k78 X-ray 2.64 D 7-234 None
5k78 X-ray 2.64 C 7-234 None
5k78 X-ray 2.64 B 7-234 None
5k78 X-ray 2.64 A 7-234 None
4peh X-ray 2.1 E 7-234 None
4peh X-ray 2.1 D 7-234 None
4peh X-ray 2.1 C 7-234 None
4peh X-ray 2.1 B 7-234 None
4peh X-ray 2.1 A 7-234 None
4pei X-ray 1.95 E 7-234 None
4pei X-ray 1.95 D 7-234 None
4pei X-ray 1.95 C 7-234 None
4pei X-ray 1.95 B 7-234 None
4pei X-ray 1.95 A 7-234 None


© NPIDB team 2003 - 2021

text