Pfam domain
Pfam family: DNA_RNApol_7kD (PF03604.15)
Uniprot AC: C4QWA8
RecName: RNA polymerase subunit, found in RNA polymerase complexes I, II, and III
Begin-End: 31-62
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
YTCGACAHNFSLNKSDPVRCKECGHRVIYKAR
Structures of the domain C4QWA8 31-62
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xon X-ray 3.83 L 31-62 None


© NPIDB team 2003 - 2021

text