Pfam domain
Pfam family: RNA_POL_M_15KD (PF02150.18)
Uniprot AC: C4QY79
RecName: DNA-directed RNA polymerase subunit
Begin-End: 9-39
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
NNMLYPKEDKENQRLLYSCRNCDYTELAEDP
Structures of the domain C4QY79 9-39
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5xon X-ray 3.83 I 4-41 None


© NPIDB team 2003 - 2021

text