Pfam domain
Pfam family: Elf1 (PF05129.15)
Uniprot AC: C4QZ45
RecName: Transcription elongation factor 1 homolog
Begin-End: 15-78
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
IKQKLETQFTCLFCNHDNSVVCTLDKKNSIGLLECKKCNLSFQAPINSLSQPIDIYSDWI
DACE
Structures of the domain C4QZ45 15-78
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j4y X-ray 4.3 M 15-78 None
6j4w X-ray 7.9 M 15-78 None
6j4x X-ray 4.3 M 15-78 None
6j51 X-ray 4.2 M 15-78 None
6ir9 X-ray 3.8 M 15-78 None


© NPIDB team 2003 - 2021

text