Pfam domain
Pfam family: RNA_pol_Rpb2_3 (PF04565.18)
Uniprot AC: C4QZQ7
RecName: DNA-directed RNA polymerase subunit beta
Begin-End: 474-538
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLS
LLSGI
Structures of the domain C4QZQ7 474-538
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j4y X-ray 4.3 B 474-538 None
6a5r X-ray 8.7 B 474-538 None
6j4z X-ray 4.1 B 474-538 None
6j4w X-ray 7.9 B 474-538 None
5xog X-ray 3 B 474-538 None
5xon X-ray 3.83 B 474-538 None
6inq X-ray 6.9 B 474-538 None
6a5o X-ray 9.9 B 474-538 None
6a5u X-ray 7.6 B 474-538 None
6a5p X-ray 7 B 474-538 None
6j4x X-ray 4.3 B 474-538 None
6j51 X-ray 4.2 B 474-538 None
6a5l X-ray 5.6 B 474-538 None
6j50 X-ray 4.7 B 474-538 None
6ir9 X-ray 3.8 B 474-538 None
6a5t X-ray 6.7 B 474-538 None


© NPIDB team 2003 - 2021

text