Pfam domain
Pfam family: RNA_pol_N (PF01194.19)
Uniprot AC: C4R009
RecName: RNA polymerase subunit ABC10-beta, common to RNA polymerases I, II, and III
Begin-End: 2-59
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
IIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVLTHVDLIEKF
Structures of the domain C4R009 2-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j4y X-ray 4.3 J 2-59 None
6a5r X-ray 8.7 J 2-59 None
6j4z X-ray 4.1 J 2-59 None
5xog X-ray 3 J 2-59 None
5xon X-ray 3.83 J 2-59 None
6inq X-ray 6.9 J 2-59 None
6a5o X-ray 9.9 J 2-59 None
6a5u X-ray 7.6 J 2-59 None
6a5p X-ray 7 J 2-59 None
6j4x X-ray 4.3 J 2-59 None
6j51 X-ray 4.2 J 2-59 None
6a5l X-ray 5.6 J 2-59 None
6j50 X-ray 4.7 J 2-59 None
6ir9 X-ray 3.8 J 2-59 None
6a5t X-ray 6.7 J 2-59 None


© NPIDB team 2003 - 2021

text