Pfam domain
Pfam family: RNA_pol_Rpb4 (PF03874.18)
Uniprot AC: C4R2U9
RecName: RNA polymerase II subunit B32
Begin-End: 50-182
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
ALSLSESRLLIREALKARSRARNGGVDIESSNGEIDDDELAKVTSGAVANGVVKKTLDYL
NTFARFKDEETCTAVDQLLHNSSDCSVLHPFEIAQLSSLGCEDVDEAITLIPSLAAKKEV
NLQRILDELNRLE
Structures of the domain C4R2U9 50-182
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j4y X-ray 4.3 D 75-182 None
6a5r X-ray 8.7 D 63-182 None
6j4z X-ray 4.1 D 50-182 None
6j4w X-ray 7.9 D 75-182 None
5xog X-ray 3 D 50-182 None
5xon X-ray 3.83 D 50-182 None
6inq X-ray 6.9 D 63-182 None
6a5o X-ray 9.9 D 63-182 None
6a5u X-ray 7.6 D 63-182 None
6a5p X-ray 7 D 63-182 None
6j4x X-ray 4.3 D 75-182 None
6j51 X-ray 4.2 D 75-182 None
6a5l X-ray 5.6 D 50-182 None
6j50 X-ray 4.7 D 75-182 None
6ir9 X-ray 3.8 D 75-182 None
6a5t X-ray 6.7 D 50-182 None


© NPIDB team 2003 - 2021

text