Pfam domain
Pfam family: RNA_pol_L_2 (PF13656.8)
Uniprot AC: C4R3Z5
RecName: RNA polymerase II subunit B12.5
Begin-End: 30-104
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
CIIIKFEREDHTLANLLREELALYPDVTFVAYKVEHPLFANFVMRLQTEEGTRPKQALER
ACASIINKLKTLDHK
Structures of the domain C4R3Z5 30-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j4y X-ray 4.3 K 30-104 None
6a5r X-ray 8.7 K 30-104 None
6j4z X-ray 4.1 K 30-104 None
6j4w X-ray 7.9 K 30-104 None
5xog X-ray 3 K 30-104 None
5xon X-ray 3.83 K 30-104 None
6inq X-ray 6.9 K 30-104 None
6a5o X-ray 9.9 K 30-104 None
6a5u X-ray 7.6 K 30-104 None
6a5p X-ray 7 K 30-104 None
6j4x X-ray 4.3 K 30-104 None
6j51 X-ray 4.2 K 30-104 None
6a5l X-ray 5.6 K 30-104 None
6j50 X-ray 4.7 K 30-104 None
6ir9 X-ray 3.8 K 30-104 None
6a5t X-ray 6.7 K 30-104 None


© NPIDB team 2003 - 2021

text