Pfam domain
Pfam family: RNA_pol_A_bac (PF01000.28)
Uniprot AC: C4R7L2
RecName: RNA polymerase II third largest subunit B44, part of central core
Begin-End: 48-171
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
VEIKMNTSVLADEFISHRLGLIPLVSEDVEEMKYSRDCTCEDYCDECSVVLELSARHEGE
EGTTDVYSSSLIKVSGPGNLNVGEPVRRDDYDQGILLCKLRNHQELNIRCIAKKGIAKEH
AKWS
Structures of the domain C4R7L2 48-171
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j4y X-ray 4.3 C 48-171 None
6a5r X-ray 8.7 C 60-171 None
6j4z X-ray 4.1 C 48-171 None
6j4w X-ray 7.9 C 48-171 None
5xog X-ray 3 C 48-171 None
5xon X-ray 3.83 C 48-171 None
6inq X-ray 6.9 C 48-171 None
6a5o X-ray 9.9 C 48-171 None
6a5u X-ray 7.6 C 60-171 None
6a5p X-ray 7 C 60-171 None
6j4x X-ray 4.3 C 48-171 None
6j51 X-ray 4.2 C 48-171 None
6a5l X-ray 5.6 C 60-171 None
6j50 X-ray 4.7 C 60-171 None
6ir9 X-ray 3.8 C 48-171 None
6a5t X-ray 6.7 C 48-171 None


© NPIDB team 2003 - 2021

text