Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: C4R9A1
RecName: RNA polymerase II subunit
Begin-End: 80-164
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
KPFKGEVVDAIVSNVSPIGFFADVGPLNVFVSTRLIPDNLVYNPSNSPPAYMSNDELITK
GSKVRLKVVGTRTDVNEIYAIGSIK
Structures of the domain C4R9A1 80-164
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j4y X-ray 4.3 G 80-164 None
6a5r X-ray 8.7 G 80-164 None
6j4z X-ray 4.1 G 93-164 None
6j4w X-ray 7.9 G 80-164 None
5xog X-ray 3 G 80-164 None
5xon X-ray 3.83 G 80-164 None
6inq X-ray 6.9 G 93-164 None
6a5o X-ray 9.9 G 93-164 None
6a5u X-ray 7.6 G 80-164 None
6a5p X-ray 7 G 80-164 None
6j4x X-ray 4.3 G 93-164 None
6j51 X-ray 4.2 G 93-164 None
6a5l X-ray 5.6 G 80-164 None
6j50 X-ray 4.7 G 80-164 None
6ir9 X-ray 3.8 G 93-164 None
6a5t X-ray 6.7 G 93-164 None


© NPIDB team 2003 - 2021

text