Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: D0C9P6
RecName: 30S ribosomal protein S12
Begin-End: 12-123
Organism: Acinetobacter baumannii
Interaction Mode:   

Sequence:
RTTLVEKSKVPALKACPQRRGVCTRVYTTTPKKPNSAMRKVCRVRLTSGFEVSSYIGGEG
HNLQEHSVVLIRGGRVKDLPGVRYHTVRGSLDCAGVKDRNQSRSKYGAKRPK
Structures of the domain D0C9P6 12-123
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6yt9 X-ray 2.7 m 12-123 None
6ypu X-ray 2.9 m 12-123 None


© NPIDB team 2003 - 2021

text