Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: D0CCZ6
RecName: 30S ribosomal protein S10
Begin-End: 12-106
Organism: Acinetobacter baumannii
Interaction Mode:   

Sequence:
RIRLKSFDHRLIDQSAQEIVETAKRTGAQVCGPIPMPTRIERFNVLTSPHVNKDARDQYE
IRTYKRLIDIVQPTDKTVDALMKLDLAAGVDVQIA
Structures of the domain D0CCZ6 12-106
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ytf X-ray 3 k 7-101 None
6ys5 X-ray 3 k 7-101 None


© NPIDB team 2003 - 2021

text