Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: D0CD11
RecName: 30S ribosomal protein S8
Begin-End: 5-131
Organism: Acinetobacter baumannii
Interaction Mode:   

Sequence:
DTVADMLTRVRNAQMAKKQTVSMPSSKLKVAIANVLQQEGYISNVEVAQEETKSTLTITL
KYFEGKPVIEMVKRVSRPGLRQYRGKDKLPSVKQGLGIAIVSTSKGIMTDRAARAAGIGG
EVIAFVS
Structures of the domain D0CD11 5-131
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6yt9 X-ray 2.7 i 5-131 None
6ypu X-ray 2.9 i 5-131 None


© NPIDB team 2003 - 2021

text