Pfam domain
Pfam family: Ribosomal_S9 (PF00380.21)
Uniprot AC: D0CG36
RecName: 30S ribosomal protein S9
Begin-End: 8-128
Organism: Acinetobacter baumannii
Interaction Mode:   

Sequence:
GRRKTATARVFLSAGTGKLVINNRTLEQYFGRETARMVVRQPLELLEATEKYDLYITVKG
GGIGGQAGAIRHGITRALIAADETLKPVLRQAGFVTRDAREVERKKLGLRKARKRPQFSK
R
Structures of the domain D0CG36 8-128
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ytf X-ray 3 j 8-128 None
6ys5 X-ray 3 j 8-128 None


© NPIDB team 2003 - 2021

text