Pfam domain
Pfam family: DNA_pol_B_exo1 (PF03104.21)
Uniprot AC: D0VWU9
RecName: DNA polymerase
Begin-End: 126-278
Organism: Thermococcus kodakarensis
Interaction Mode:  L-Bb 

Sequence:
LVPMEGDEELKMLAFDIETLYEEGEEFAEGPILMISYADEEGARVITWKNVDLPYVDVVS
TEREMIKRFLRVVKEKDPDVLITYNGDNFDFAYLKKRCEKLGINFALGRDGSEPKIQRMG
DRFAVEVKGRIHFDLYPVIRRTINLPTYTLEAV
Structures of the domain D0VWU9 126-278
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5vu6 X-ray 3 A 126-278  L-Bb 
6wya X-ray 2.41 A 127-278  L-Bb 
5vu7 X-ray 2.72 A 126-278  L-Bb 
5vu8 X-ray 3.2 A 126-278 None
5vu9 X-ray 2.05 A 126-278  L-Bb 
6wyb X-ray 2.5 A 127-278 None


© NPIDB team 2003 - 2021

text