Pfam domain
Pfam family: RVT_1 (PF00078.29)
Uniprot AC: D3XFN7
RecName: Protease (Fragment)
Begin-End: 162-333
Organism: Human immunodeficiency virus 1
Interaction Mode:   

Sequence:
IKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDK
DFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYEL
Structures of the domain D3XFN7 162-333
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ika X-ray 2.6 A 63-234 None
6ika X-ray 2.6 C 63-234 None
6ik9 X-ray 2.44 A 63-234 None
6ik9 X-ray 2.44 C 63-234 None


© NPIDB team 2003 - 2021

text