Pfam domain
Pfam family: RNase_H (PF00075.26)
Uniprot AC: D3XFN7
RecName: Protease (Fragment)
Begin-End: 535-652
Organism: Human immunodeficiency virus 1
Interaction Mode:  L-Bb 

Sequence:
GAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQAIHLALQDSGLEVNI
VTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVS
Structures of the domain D3XFN7 535-652
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ika X-ray 2.6 A 436-553  L-Bb 
6ika X-ray 2.6 C 436-553  L-Bb 
6ik9 X-ray 2.44 A 436-553  L-Bb 
6ik9 X-ray 2.44 C 436-553  L-Bb 


© NPIDB team 2003 - 2021

text