Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: D8A1L7
RecName: 30S ribosomal protein S8
Begin-End: 5-130
Organism: Escherichia coli
Interaction Mode:   

Sequence:
DPIADMLTRIRNGQAANKAAVTMPSSKLKVAIANVLKEEGFIEDFKVEGDTKPELELTLK
YFQGKAVVESIQRVSRPGLRIYKRKDELPKVMAGLGIAVVSTSKGVMTDRAARQAGLGGE
IICYVA
Structures of the domain D8A1L7 5-130
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6o7k X-ray 4.2 p 6-129 None
6nqb X-ray 3.8 H 4-129 None


© NPIDB team 2003 - 2021

text