Pfam domain
Pfam family: DNA_pol_A (PF00476.22)
Uniprot AC: D9N168
RecName: DNA polymerase I
Begin-End: 200-577
Organism: Geobacillus stearothermophilus
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
TKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYST
SADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPATKKVHTIFNQALTQTGRL
SSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFR
RDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNFGIPYGISDYGLAQNLNISRKEAAEFI
ERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPI
QGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAV
TLRVPLKVDYHYGSTWYD
Structures of the domain D9N168 200-577
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ur9 X-ray 2.1 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
6ur9 X-ray 2.1 D 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
6ur4 X-ray 2.25 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
6p5c X-ray 2.2 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
6ueu X-ray 1.8 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
6ueu X-ray 1.8 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
4o0i X-ray 2.2 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
3ht3 X-ray 1.7 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
3ht3 X-ray 1.7 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
6us5 X-ray 2.25 A 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
6us5 X-ray 2.25 D 497-874  H-Bb H-Mn S-Bb L-Bb L-Mn 
6ur2 X-ray 2.27 A 497-874  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text