Pfam domain
Pfam family: RVT_1 (PF00078.29)
Uniprot AC: E2GM63
RecName: Trt
Begin-End: 67-274
Organism: Geobacillus stearothermophilus
Interaction Mode:   

Sequence:
IPKPGGGTRQLGIPTVVDRLIQQAILQELTPIFDPDFSSSSFGFRPGRNAHDAVRQAQGY
IQEGYRYVVDMDLEKFFDRVNHDILMSRVARKVKDKRVLKLIRAYLQAGVMIEGVKVQTE
EGTPQGGPLSPLLANILLDDLDKELEKRGLKFCRYADDCNIYVKSLRAGQRVKQSIQRFL
EKTLKLKVNEEKSAVDRPWKRAFLGFSF
Structures of the domain E2GM63 67-274
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6ar3 X-ray 3.41 D 67-274 None
6ar3 X-ray 3.41 A 67-274 None
6ar1 X-ray 3.01 A 67-274 None
6ar1 X-ray 3.01 D 67-274 None


© NPIDB team 2003 - 2021

text