Pfam domain
Pfam family: T_Ag_DNA_bind (PF02217.18)
Uniprot AC: E2IPT4
RecName: Large T antigen (Fragment)
Begin-End: 235-327
Organism: Merkel cell polyomavirus
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj 

Sequence:
TDFPIDLSDYLSHAVYSNKTVSCFAIYTTSDKAIELYDKIEKFKVDFKSRHACELGCILL
FITLSKHRVSAIKNFCSTFCTISFLICKGVNKM
Structures of the domain E2IPT4 235-327
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3qfq X-ray 2.9 E 313-405  H-Bb S-Bb S-Mj L-Bb L-Mj 
3qfq X-ray 2.9 A 313-405  H-Bb S-Bb L-Bb L-Mj 
3qfq X-ray 2.9 B 313-405  H-Bb L-Bb L-Mj 


© NPIDB team 2003 - 2021

text