Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: E2RXT0
RecName: 30S ribosomal protein S10
Begin-End: 8-101
Organism: Pseudomonas aeruginosa
Interaction Mode:   

Sequence:
IRLKAFDHRLIDQSTQEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKDARDQYEI
RTHKRVLDIVQPTDKTVDALMKLDLAAGVEVQIS
Structures of the domain E2RXT0 8-101
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6spe X-ray 3.6 j 8-101 None
6spc X-ray 2.95 j 8-101 None


© NPIDB team 2003 - 2021

text