Pfam domain
Pfam family: Ribosomal_S8 (PF00410.21)
Uniprot AC: E2RXT9
RecName: 30S ribosomal protein S8
Begin-End: 5-126
Organism: Pseudomonas aeruginosa
Interaction Mode:   

Sequence:
DPLADMLTRIRNAQMAEKTVVSMPSSKLKAAVAKVLKDEGYIADFQISSEVKPQLSIELK
YFEGKPVIEEVKRISRPGLRQYKSVEQLPKVRGGLGVSIVSTNKGVMTDRAARAAGVGGE
VL
Structures of the domain E2RXT9 5-126
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6spe X-ray 3.6 h 5-130 None
6spc X-ray 2.95 h 5-129 None


© NPIDB team 2003 - 2021

text