Pfam domain
Pfam family: RNase_HII (PF01351.20)
Uniprot AC: E8T217
RecName: Ribonuclease
Begin-End: 75-266
Organism: Thermovibrio ammonificans
Interaction Mode:   

Sequence:
IGCDEAGKGEFVGPLVVACIVADEKCLKRLIELGVKDSKKLSNEKVEELASEITETCHGK
VKLLIPEKYNRAYSKFKNINRLLEAVYREIVSDLCEKFSPKVVVVDKFSNRAEEVLKDVV
KGARLEVRPKAEDDLAVAAASIVAKAVRLKTMKELEKRFKVKLPEGNTGLAELLKKTPKE
LHEKLFKLHFSV
Structures of the domain E8T217 75-266
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4py5 X-ray 2.1 A 75-265 None


© NPIDB team 2003 - 2021

text