Pfam domain
Pfam family: Ribosomal_S10 (PF00338.24)
Uniprot AC: F1RUU2
RecName: Uncharacterized protein
Begin-End: 76-172
Organism: Sus scrofa
Interaction Mode:   

Sequence:
LSVLVKGHDKAVLDSYEYFAVLAAKELGISIKVHEPPRKIERFTLLKSVHIFKKHRVQYE
MRTLYRCLELEHLTGSTADVYLEYIQRNLPEGVAMEV
Structures of the domain F1RUU2 76-172
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5aj3 X-ray 3.6 J 77-173 None


© NPIDB team 2003 - 2021

text