Pfam domain
Pfam family: RNA_pol_Rpb6 (PF01192.24)
Uniprot AC: F1SKN8
RecName: RNA polymerase II subunit F
Begin-End: 51-104
Organism: Sus scrofa
Interaction Mode:   

Sequence:
RITTPYMTKYERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPI
Structures of the domain F1SKN8 51-104
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 F 51-104 None
6gmh X-ray 3.1 F 51-104 None
6exv X-ray 3.6 F 51-104 None
6ted X-ray 3.1 F 51-104 None


© NPIDB team 2003 - 2021

text