Pfam domain
Pfam family: RNA_POL_M_15KD (PF02150.18)
Uniprot AC: F2QPE6
RecName: DNA-directed RNA polymerase subunit
Begin-End: 4-41
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
FRFCLECNNMLYPKEDKENQRLLYSCRNCDYTELAEDP
Structures of the domain F2QPE6 4-41
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j4y X-ray 4.3 I 4-41 None
6a5r X-ray 8.7 I 4-41 None
6j4z X-ray 4.1 I 4-41 None
6j4w X-ray 7.9 I 4-41 None
5xog X-ray 3 I 4-41 None
6inq X-ray 6.9 I 4-41 None
6a5o X-ray 9.9 I 4-41 None
6a5u X-ray 7.6 I 4-41 None
6a5p X-ray 7 I 4-41 None
6j4x X-ray 4.3 I 4-41 None
6j51 X-ray 4.2 I 4-41 None
6a5l X-ray 5.6 I 4-41 None
6j50 X-ray 4.7 I 4-41 None
6ir9 X-ray 3.8 I 4-41 None
6a5t X-ray 6.7 I 4-41 None


© NPIDB team 2003 - 2021

text