Pfam domain
Pfam family: RNA_pol_N (PF01194.19)
Uniprot AC: F2QTN1
RecName: RNA polymerase subunit ABC10-beta
Begin-End: 2-59
Organism: Komagataella phaffii
Interaction Mode:   

Sequence:
IIPVRCFSCGKVVGDKWDAYLRLLEEGKQEGDALDELKLKRYCCRRMVLTHVDLIEKF
Structures of the domain F2QTN1 2-59
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6j4w X-ray 7.9 J 2-59 None


© NPIDB team 2003 - 2021

text