Pfam domain
Pfam family: XPG_I (PF00867.20)
Uniprot AC: G0RYN2
RecName: Nuclease-like protein
Begin-End: 111-198
Organism: Chaetomium thermophilum
Interaction Mode:  S-Bb L-Bb 

Sequence:
GFTAHDAPGEAEAECAYLEQQGIVDAVLSEDVDTIMFGSRVTLRDWSSEGSKGGPPTHVT
LHDAKKIAEGPSGLDREGMVLVALMSGG
Structures of the domain G0RYN2 111-198
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5cnq X-ray 2.6 A 111-198 None
5co8 X-ray 2.4 A 111-203 None
5co8 X-ray 2.4 C 111-199  L-Bb 
6grc X-ray 2.45 A 111-199 None
6grb X-ray 2.4 A 111-199  S-Bb L-Bb 
6grd X-ray 2.66 A 111-199 None


© NPIDB team 2003 - 2021

text