Pfam domain
Pfam family: DEAD (PF00270.31)
Uniprot AC: G0S700
RecName: Putative pre-mRNA splicing factor
Begin-End: 560-719
Organism: Chaetomium thermophilum
Interaction Mode:   

Sequence:
FQFRDQIIQAVKDNQILIVVGETGSGKTTQVTQYLAEAGFTKYGMIGCTQPRRVAAVSVA
KRVAEEVGCQLGQEVGYTIRFEDVTSPATKIKYMTDGMLQREILMDPDLKRYSVIMLDEA
HERTIATDVLFALLKKTVKRRPDLKVIVTSATLDAEKFSE
Structures of the domain G0S700 560-719
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6i3p X-ray 2.75 A 560-719 None
6i3p X-ray 2.75 B 560-719 None
6i3p X-ray 2.75 C 560-719 None
6i3p X-ray 2.75 D 560-719 None
6qic X-ray 2.7 A 560-719 None
6qic X-ray 2.7 B 560-719 None
6qic X-ray 2.7 C 560-719 None
6qic X-ray 2.7 D 560-719 None


© NPIDB team 2003 - 2021

text