Pfam domain
Pfam family: SNF2-rel_dom (PF00176.25)
Uniprot AC: G0S9L5
RecName: Complex ATPase-like protein
Begin-End: 188-469
Organism: Chaetomium thermophilum
Interaction Mode:   

Sequence:
YQIAGLNWLISLHENGISGILADEMGLGKTLQTISFLGYLRHIQGITGPHLVAVPKSTLD
NWKREFEKWTPDVNVLVLQGAKEERHQLINDRLIDEDFDVCITSYEMILREKAHLKKFAW
EYIIIDEAHRIKNEESSLSQVIRMFSSRNRLLITGTPLQNNLHELWALLNFLLPDVFGDS
DAFDQWFRGQDRDQDQVVQQLHRVLRPFLLRRVKSDVEKSLLPKKEINVYIGMSEMQVKW
YKKILEKDIDAVNGAGGKRESKTRLLNIVMQLRKCCNHPYLF
Structures of the domain G0S9L5 188-469
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6pwf X-ray 4.07 K 188-469 None


© NPIDB team 2003 - 2021

text