Pfam domain
Pfam family: HSF_DNA-bind (PF00447.19)
Uniprot AC: G0SB31
RecName: Transcription factor SKN7
Begin-End: 43-142
Organism: Chaetomium thermophilum
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb 

Sequence:
FVRKLYKMLEDPSYHSVVRWSDDGDSFVVLENEKFTKTILPKHFKHSNFASFVRQLNKYD
FHKVRHNDENGESPYGRDAWEFKHPEFRADRKDNLDNIRR
Structures of the domain G0SB31 43-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5d5w X-ray 2.35 B 43-142 None
5d5x X-ray 2.4 B 43-143  H-Bb H-Mj S-Bb L-Bb 
5d5x X-ray 2.4 E 43-143  H-Bb H-Mj S-Bb L-Bb 


© NPIDB team 2003 - 2021

text