Pfam domain
Pfam family: S4 (PF01479.27)
Uniprot AC: G0SDL4
RecName: Uncharacterized protein
Begin-End: 109-156
Organism: Chaetomium thermophilum
Interaction Mode:   

Sequence:
RRLPVVMTRLRMAETVQAATKLIEQGHVRVGVEEVRDPAFLVTRNMED
Structures of the domain G0SDL4 109-156
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5jpq X-ray 7.3 b 109-156 None


© NPIDB team 2003 - 2021

text