Pfam domain
Pfam family: Ribosom_S12_S23 (PF00164.27)
Uniprot AC: G1SZ47
RecName: Uncharacterized protein
Begin-End: 29-140
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
KAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPND
GCLNFIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALYKGKKER
Structures of the domain G1SZ47 29-140
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6yal X-ray 3 Z 29-142 None
4d5l X-ray 9 X 29-140 None
4kzx X-ray 7.81 X 29-142 None
4kzy X-ray 7.01 X 29-142 None
4kzz X-ray 7.03 X 29-142 None
7jqc X-ray 3.3 c 29-142 None
6p4h X-ray 3.2 Y 29-142 None
4d61 X-ray 9 X 29-140 None
6p4g X-ray 3.1 Y 29-142 None
5k0y X-ray 5.8 Q 29-142 None
6yan X-ray 3.48 Z 29-142 None
7jqb X-ray 2.7 c 49-162 None


© NPIDB team 2003 - 2021

text