Pfam domain
Pfam family: S1 (PF00575.25)
Uniprot AC: G1T2G4
RecName: Eukaryotic translation initiation factor 2 subunit 1
Begin-End: 14-88
Organism: Oryctolagus cuniculus
Interaction Mode:   

Sequence:
PEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRSINKLIRIGRNECVVV
IRVDKEKGYIDLSKR
Structures of the domain G1T2G4 14-88
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6yal X-ray 3 A 14-88 None
5k0y X-ray 5.8 P 90-88 None
6yan X-ray 3.48 A 11-85 None


© NPIDB team 2003 - 2021

text