Pfam domain
Pfam family: MerR_1 (PF13411.8)
Uniprot AC: G2RUZ1
RecName: HTH-type transcriptional regulator TnrA
Begin-End: 14-82
Organism: Bacillus megaterium
Interaction Mode:   

Sequence:
MSIGIVKELTGLSERQIRYYEKRSLLFPDRTNTGIRKYSFSDVERLMDIADRIEEGVQTS
EIRTELAKK
Structures of the domain G2RUZ1 14-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4r22 X-ray 2.6 B 14-82 None
4r24 X-ray 2.25 B 14-82 None


© NPIDB team 2003 - 2021

text