Pfam domain
Pfam family: Cas_Cas1 (PF01867.18)
Uniprot AC: G3ECR2
RecName: CRISPR-associated endonuclease Cas1
Begin-End: 6-278
Organism: Streptococcus thermophilus
Interaction Mode:   

Sequence:
TVVVNIHSKLSYKNNHLIFRNSYKTEMIHLSEIDILLLETTDIVLTTMLVKRLVDENILV
IFCDDKRLPTAFLTPYYARHDSSLQIARQIAWKENVKCEVWTAIIAQKILNQSYYLGECS
FFEKSQSIMELYHGLERFDPSNREGHSARIYFNTLFGNDFTRESDNDINAALDYGYTLLL
SMFAREVVVCGCMTQIGLKHANQFNQFNLASDIMEPFRPIIDRIVYQNRHNNFVKIKKEL
FSIFSETYLYNGKEMYLSNIVSDYTKKVIKALN
Structures of the domain G3ECR2 6-278
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6qxf X-ray 3.6 L 6-278 None
6qxf X-ray 3.6 S 6-278 None
6qxf X-ray 3.6 R 6-278 None
6qxf X-ray 3.6 P 6-278 None
6qxf X-ray 3.6 O 6-278 None
6qxf X-ray 3.6 M 6-278 None
6qxf X-ray 3.6 I 6-278 None
6qxf X-ray 3.6 J 6-278 None
6qy3 X-ray 9.1 z 6-278 None
6qy3 X-ray 9.1 y 6-278 None
6qy3 X-ray 9.1 v 6-278 None
6qy3 X-ray 9.1 u 6-278 None
6qy3 X-ray 9.1 s 6-278 None
6qy3 X-ray 9.1 m 6-278 None
6qy3 X-ray 9.1 r 6-278 None
6qy3 X-ray 9.1 p 6-278 None
6qy3 X-ray 9.1 o 6-278 None
6qy3 X-ray 9.1 j 6-278 None
6qy3 X-ray 9.1 l 6-278 None
6qy3 X-ray 9.1 i 6-278 None
6qy3 X-ray 9.1 Z 6-278 None
6qy3 X-ray 9.1 Y 6-278 None
6qy3 X-ray 9.1 V 6-278 None
6qy3 X-ray 9.1 U 6-278 None
6qy3 X-ray 9.1 S 6-278 None
6qy3 X-ray 9.1 R 6-278 None
6qy3 X-ray 9.1 P 6-278 None
6qy3 X-ray 9.1 O 6-278 None
6qy3 X-ray 9.1 M 6-278 None
6qy3 X-ray 9.1 L 6-278 None
6qy3 X-ray 9.1 J 6-278 None
6qy3 X-ray 9.1 I 6-278 None
6qxt X-ray 8.9 s 6-278 None
6qxt X-ray 8.9 z 6-278 None
6qxt X-ray 8.9 y 6-278 None
6qxt X-ray 8.9 v 6-278 None
6qxt X-ray 8.9 u 6-278 None
6qxt X-ray 8.9 r 6-278 None
6qxt X-ray 8.9 p 6-278 None
6qxt X-ray 8.9 o 6-278 None
6qxt X-ray 8.9 m 6-278 None
6qxt X-ray 8.9 l 6-278 None
6qxt X-ray 8.9 i 6-278 None
6qxt X-ray 8.9 j 6-278 None
6qxt X-ray 8.9 Z 6-278 None
6qxt X-ray 8.9 Y 6-278 None
6qxt X-ray 8.9 V 6-278 None
6qxt X-ray 8.9 U 6-278 None
6qxt X-ray 8.9 S 6-278 None
6qxt X-ray 8.9 R 6-278 None
6qxt X-ray 8.9 P 6-278 None
6qxt X-ray 8.9 O 6-278 None
6qxt X-ray 8.9 J 6-278 None
6qxt X-ray 8.9 L 6-278 None
6qxt X-ray 8.9 M 6-278 None
6qxt X-ray 8.9 I 6-278 None


© NPIDB team 2003 - 2021

text