Pfam domain
Pfam family: CRISPR_Cas2 (PF09827.11)
Uniprot AC: G3ECR3
RecName: CRISPR-associated endoribonuclease Cas2
Begin-End: 6-85
Organism: Streptococcus thermophilus
Interaction Mode:   

Sequence:
MRMILMFDMPTDTAEERKAYRKFRKFLLSEGFIMHQFSVYSKLLLNHTANTAMVGRLKAN
NPKKGNITILTVTEKQFARM
Structures of the domain G3ECR3 6-85
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6qxt X-ray 8.9 q 6-85 None
6qxt X-ray 8.9 x 6-85 None
6qxt X-ray 8.9 w 6-85 None
6qxt X-ray 8.9 t 6-85 None
6qxt X-ray 8.9 n 6-85 None
6qxt X-ray 8.9 k 6-85 None
6qxt X-ray 8.9 X 6-85 None
6qxt X-ray 8.9 W 6-85 None
6qxt X-ray 8.9 T 6-85 None
6qxt X-ray 8.9 Q 6-85 None
6qxt X-ray 8.9 N 6-85 None
6qxt X-ray 8.9 K 6-85 None


© NPIDB team 2003 - 2021

text