Pfam domain
Pfam family: Cas_Csn2 (PF09711.12)
Uniprot AC: G3ECR4
RecName: CRISPR-associated protein Csn2
Begin-End: 37-212
Organism: Streptococcus thermophilus
Interaction Mode:   

Sequence:
QYDEQSNLTIFDSKIRSIRSSELLLITDILGYDINTSQVLKLLHTDIVSQLNDKPEVRSE
IDSLVSLITDIIMAECIENELDIEYDEITLLELIKALGVRIETKSCTVFEKIFEILQIFK
YLVKKRILVFVNSLSYFSKDEIYQILEYTKLSQADVLFLEPRQIEGIQQFILDKDY
Structures of the domain G3ECR4 37-212
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6qxf X-ray 3.6 D 37-212  H-Bb L-Bb 
6qxf X-ray 3.6 E 37-212 None
6qxf X-ray 3.6 A 37-212 None
6qxf X-ray 3.6 B 37-212  L-Bb 
6qxf X-ray 3.6 C 37-212 None
6qxf X-ray 3.6 G 37-212 None
6qxf X-ray 3.6 H 37-212  L-Bb 
6qxf X-ray 3.6 F 37-212  H-Bb 
6qy3 X-ray 9.1 h 37-212 None
6qy3 X-ray 9.1 f 37-212 None
6qy3 X-ray 9.1 g 37-212 None
6qy3 X-ray 9.1 e 37-212 None
6qy3 X-ray 9.1 d 37-212 None
6qy3 X-ray 9.1 a 37-212 None
6qy3 X-ray 9.1 b 37-212 None
6qy3 X-ray 9.1 c 37-212 None
6qy3 X-ray 9.1 A 37-212 None
6qy3 X-ray 9.1 B 37-212 None
6qy3 X-ray 9.1 H 37-212 None
6qy3 X-ray 9.1 D 37-212 None
6qy3 X-ray 9.1 E 37-212 None
6qy3 X-ray 9.1 F 37-212 None
6qy3 X-ray 9.1 G 37-212 None
6qy3 X-ray 9.1 C 37-212 None
6qxt X-ray 8.9 c 37-212 None
6qxt X-ray 8.9 d 37-212 None
6qxt X-ray 8.9 e 37-212 None
6qxt X-ray 8.9 f 37-212 None
6qxt X-ray 8.9 h 37-212 None
6qxt X-ray 8.9 g 37-212 None
6qxt X-ray 8.9 a 37-212 None
6qxt X-ray 8.9 b 37-212 None
6qxt X-ray 8.9 D 37-212 None
6qxt X-ray 8.9 E 37-212 None
6qxt X-ray 8.9 F 37-212 None
6qxt X-ray 8.9 G 37-212 None
6qxt X-ray 8.9 H 37-212 None
6qxt X-ray 8.9 A 37-212 None
6qxt X-ray 8.9 B 37-212 None
6qxt X-ray 8.9 C 37-212 None


© NPIDB team 2003 - 2021

text