Pfam domain
Pfam family: RNA_pol_Rpb1_5 (PF04998.19)
Uniprot AC: G3MZY8
RecName: DNA-directed RNA polymerase subunit
Begin-End: 830-1427
Organism: Bos taurus
Interaction Mode:   

Sequence:
GLTPTEFFFHAMGGREGLIDTAVKTAETGYIQRRLIKSMESVMVKYDATVRNSINQVVQL
RYGEDGLAGESVEFQNLATLKPSNKAFEKKFRFDYTNERALRRTLQEDLVKDVLSNAHIQ
NELEREFERMREDREVLRVIFPTGDSKVVLPCNLLRMIWNAQKIFHINPRLPSDLHPIKV
VEGVKELSKKLVIVNGDDPLSRQAQENATLLFNIHLRSTLCSRRMAEEFRLSGEAFDWLL
GEIESKFNQAIAHPGEMVGALAAQSLGEPATQMTLNTFHYAGVSAKNVTLGVPRLKELIN
ISKKPKTPSLTVFLLGQSARDAERAKDILCRLEHTTLRKVTANTAIYYDPNPQSTVVAED
QEWVNVYYEMPDFDVARISPWLLRVELDRKHMTDRKLTMEQIAEKINAGFGDDLNCIFND
DNAEKLVLRIRIMNSDENKMQEEEEVVDKMDDDVFLRCIESNMLTDMTLQGIEQISKVTC
HLPQTDNKKKITMTHDASFKKYFYLFQLETDGVSLMRVLSEKDVDPVRTTSNDIVEIFTV
LGIEAVRKALERELYHVISFDGSYVNYRHLALLCDTMTCRGHLMAITRHGVNRQDTGP
Structures of the domain G3MZY8 830-1427
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5flm X-ray 3.4 A 830-1427  H-Bb 
5oik X-ray 3.7 A 830-1427 None


© NPIDB team 2003 - 2021

text