Pfam domain
Pfam family: RNA_pol_Rpb8 (PF03870.17)
Uniprot AC: I3LCB2
RecName: DNA-directed RNA polymerases I, II, and III subunit RPABC3
Begin-End: 7-147
Organism: Sus scrofa
Interaction Mode:   

Sequence:
EDIFDVKDIDPEGKKFDRVSRLHCESESFKMDLILDVNIQIYPVDLGDKFRLVIASTLYE
DGTLDDGEYNPTDDRPSRADQFEYVMYGKVYRIEGDETSTEAATRLSAYVSYGGLLMRLQ
GDANNLHGFEVDSRVYLLMKK
Structures of the domain I3LCB2 7-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gml X-ray 3.2 H 7-147 None
6gmh X-ray 3.1 H 7-147 None
6exv X-ray 3.6 H 7-147 None
6ted X-ray 3.1 H 7-147 None


© NPIDB team 2003 - 2021

text